PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA20032
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family SRS
Protein Properties Length: 411aa    MW: 42507.4 Da    PI: 8.0599
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA20032genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702208.51.7e-641863473154
                     DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsal 86 
                                 gt++CqdCGnqakkdC+ +RCRtCCksrgfdC thvkstWvpaa+rrer + + +++  a    ++ ++   ++ +  +++++
  Tp57577_TGAC_v2_mRNA20032 186 GGTTTCQDCGNQAKKDCSNRRCRTCCKSRGFDCPTHVKSTWVPAARRRERLASAGTTTVVAGGGCSSGSTSGAKKPRLIASQTT 269
                                5789**********************************************9999998888877776655555555556688888 PP

                     DUF702  87 sstklssaeskkeletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                                s+t++s+++++++++t+s          +P +v+++a+f+cvrv+svddg++e+aYq++v+igGhvfkG+Lyd+G+e+
  Tp57577_TGAC_v2_mRNA20032 270 SHTSTSNTTPPRSFDTTSshqdagfkesMPGQVRAPAIFKCVRVTSVDDGKDEYAYQAVVKIGGHVFKGFLYDHGVEN 347
                                999999******999999999******************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.2E-60188346IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.2E-26190232IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016243.2E-28298345IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
LASDSGAFAD WAATSSSTVR AAAPEDLSLG FNAGPTAAGN AGPSTGPTTG IWSGGGGSRS  60
VNYGPEMGMF VVAPSPYHPH HHHHSHHGNH HEAIISDPHS LNPATALGVG VIPLLTASPL  120
DNERQQQGIQ FWHEQQQQHQ HHSNYLKKHQ GFLDHHINTS PTNLVHHGGG GGGGGGLTGS  180
GTSSGGGTTT CQDCGNQAKK DCSNRRCRTC CKSRGFDCPT HVKSTWVPAA RRRERLASAG  240
TTTVVAGGGC SSGSTSGAKK PRLIASQTTS HTSTSNTTPP RSFDTTSSHQ DAGFKESMPG  300
QVRAPAIFKC VRVTSVDDGK DEYAYQAVVK IGGHVFKGFL YDHGVENREV YPNLSELHLG  360
GGGNNNNGGA NRNVVSSSSP MLDPSHDVYA AASSGVGGLL GGSAYGNQIN *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR9621261e-140CR962126.2 Medicago truncatula chromosome 5 clone mth2-143k7, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003617270.21e-174lateral root primordium (LRP)-like protein
SwissprotQ94CK92e-83LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLG7K3571e-174G7K357_MEDTR; Lateral root primordium (LRP)-like protein
STRINGGLYMA02G44860.21e-133(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.41e-69Lateral root primordium (LRP) protein-related